Lineage for d5hr1f_ (5hr1 F:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2455317Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2455611Protein automated matches [190442] (13 species)
    not a true protein
  7. 2455634Species Escherichia coli [TaxId:83334] [279735] (2 PDB entries)
  8. 2455640Domain d5hr1f_: 5hr1 F: [330058]
    automated match to d2trxa_
    complexed with cu; mutant

Details for d5hr1f_

PDB Entry: 5hr1 (more details), 2.14 Å

PDB Description: crystal structure of thioredoxin l107a mutant
PDB Compounds: (F:) Thioredoxin-1

SCOPe Domain Sequences for d5hr1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hr1f_ c.47.1.1 (F:) automated matches {Escherichia coli [TaxId: 83334]}
dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldana

SCOPe Domain Coordinates for d5hr1f_:

Click to download the PDB-style file with coordinates for d5hr1f_.
(The format of our PDB-style files is described here.)

Timeline for d5hr1f_: