Lineage for d5hr1f_ (5hr1 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876219Species Escherichia coli [TaxId:562] [52836] (55 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. 2876253Domain d5hr1f_: 5hr1 F: [330058]
    automated match to d2trxa_
    complexed with cu; mutant

Details for d5hr1f_

PDB Entry: 5hr1 (more details), 2.14 Å

PDB Description: crystal structure of thioredoxin l107a mutant
PDB Compounds: (F:) Thioredoxin-1

SCOPe Domain Sequences for d5hr1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hr1f_ c.47.1.1 (F:) Thioredoxin {Escherichia coli [TaxId: 562]}
dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldana

SCOPe Domain Coordinates for d5hr1f_:

Click to download the PDB-style file with coordinates for d5hr1f_.
(The format of our PDB-style files is described here.)

Timeline for d5hr1f_: