Lineage for d5hr1a_ (5hr1 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484065Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2484376Protein automated matches [190442] (14 species)
    not a true protein
  7. 2484401Species Escherichia coli [TaxId:83334] [279735] (2 PDB entries)
  8. 2484402Domain d5hr1a_: 5hr1 A: [330044]
    automated match to d2trxa_
    complexed with cu; mutant

Details for d5hr1a_

PDB Entry: 5hr1 (more details), 2.14 Å

PDB Description: crystal structure of thioredoxin l107a mutant
PDB Compounds: (A:) Thioredoxin-1

SCOPe Domain Sequences for d5hr1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hr1a_ c.47.1.1 (A:) automated matches {Escherichia coli [TaxId: 83334]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldana

SCOPe Domain Coordinates for d5hr1a_:

Click to download the PDB-style file with coordinates for d5hr1a_.
(The format of our PDB-style files is described here.)

Timeline for d5hr1a_: