| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
| Protein Enolase [51606] (11 species) Fold of this protein slightly differs from common fold in topology |
| Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (15 PDB entries) Uniprot P09104 |
| Domain d5idzb2: 5idz B:141-434 [330032] Other proteins in same PDB: d5idza1, d5idza3, d5idzb1 automated match to d2akza1 complexed with 6bm, mg, pge |
PDB Entry: 5idz (more details), 2.63 Å
SCOPe Domain Sequences for d5idzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5idzb2 c.1.11.1 (B:141-434) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky
gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld
fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl
tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnpsvl
Timeline for d5idzb2: