![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
![]() | Protein Class theta GST [81361] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52874] (3 PDB entries) |
![]() | Domain d2ljra2: 2ljr A:1-79 [33003] Other proteins in same PDB: d2ljra1, d2ljrb1 |
PDB Entry: 2ljr (more details), 3.2 Å
SCOPe Domain Sequences for d2ljra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} mglelfldlvsqpsravyifakkngiplelrtvdlvkgqhkskeflqinslgklptlkdg dfiltessailiylsckyq
Timeline for d2ljra2: