SCOPe 2.08: Domain d5idza1: 5idz A:1-140

Lineage for d5idza1 (5idz A:1-140)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (10 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (15 PDB entries)
   Uniprot P09104

8. Domain d5idza1: 5idz A:1-140 [330022]
   Other proteins in same PDB: d5idza2, d5idza3, d5idzb2
   automated match to d2akza2
   complexed with 6bm, mg, pge

Details for d5idza1

PDB Entry: 5idz, 2.63 Å

PDB Description: structure of human enolase 2 in complex with (s)-(1-hydroxy-2- oxopiperidin-3-yl)phosphonate

PDB Compounds: (A:) Gamma-enolase

SCOPe Domain Sequences for d5idza1:

Sequence; same for both SEQRES and ATOM records:

>d5idza1 d.54.1.1 (A:1-140) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
agaaerelplyrhiaqlagn

Timeline for d5idza1:

• d5idza1 first appeared in SCOPe 2.06
  
• d5idza1 appears in SCOPe 2.07