SCOPe 2.07: Domain d5gouj_: 5gou J:

Lineage for d5gouj_ (5gou J:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (34 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187027] (50 PDB entries)

8. Domain d5gouj_: 5gou J: [330004]
   automated match to d3ajoa_

Details for d5gouj_

PDB Entry: 5gou, 2.91 Å

PDB Description: structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign

PDB Compounds: (J:) ferritin heavy chain

SCOPe Domain Sequences for d5gouj_:

Sequence, based on SEQRES records:

>d5gouj_ a.25.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaeklmklqn
qrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdkndphlcdfie
thyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgd

Sequence, based on observed residues (ATOM records):

>d5gouj_ a.25.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaeklmklqn
qrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklaneqvkaikelgdh
vtnlrkmgapesglaeylfdkhtlgd

Timeline for d5gouj_:

• d5gouj_ first appeared in SCOPe 2.06
  
• d5gouj_ appears in the current release, SCOPe 2.08