Lineage for d5goua_ (5gou A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1990371Protein automated matches [190041] (27 species)
    not a true protein
  7. 1990639Species Human (Homo sapiens) [TaxId:9606] [187027] (25 PDB entries)
  8. 1990680Domain d5goua_: 5gou A: [329996]
    automated match to d3ajoa_

Details for d5goua_

PDB Entry: 5gou (more details), 2.91 Å

PDB Description: structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign
PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d5goua_:

Sequence, based on SEQRES records: (download)

>d5goua_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaeklmklqnqr
ggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdkndphlcdfieth
yllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgd

Sequence, based on observed residues (ATOM records): (download)

>d5goua_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaeklmklqnqr
ggriflqdikkpdcddwesglnamecalhleknvnqsllelhneqvkaikelgdhvtnlr
kmgapesglaeylfdkhtlgd

SCOPe Domain Coordinates for d5goua_:

Click to download the PDB-style file with coordinates for d5goua_.
(The format of our PDB-style files is described here.)

Timeline for d5goua_: