| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein automated matches [190041] (34 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187027] (50 PDB entries) |
| Domain d5goug_: 5gou G: [329990] automated match to d3ajoa_ |
PDB Entry: 5gou (more details), 2.91 Å
SCOPe Domain Sequences for d5goug_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5goug_ a.25.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
astsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqshee
rehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklat
dkndphlcdfieth
Timeline for d5goug_: