![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein (Apo)ferritin [47246] (8 species) |
![]() | Species Human (Homo sapiens), H chain [TaxId:9606] [47247] (46 PDB entries) |
![]() | Domain d5goug_: 5gou G: [329990] automated match to d3ajoa_ |
PDB Entry: 5gou (more details), 2.91 Å
SCOPe Domain Sequences for d5goug_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5goug_ a.25.1.1 (G:) (Apo)ferritin {Human (Homo sapiens), H chain [TaxId: 9606]} astsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqshee rehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklat dkndphlcdfieth
Timeline for d5goug_: