![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
![]() | Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
![]() | Protein Purine nucleoside phosphorylase, PNP [53169] (14 species) |
![]() | Species Escherichia coli [TaxId:331111] [329984] (1 PDB entry) |
![]() | Domain d5i3cb_: 5i3c B: [329985] automated match to d1k9sa_ complexed with ac2, so4 |
PDB Entry: 5i3c (more details), 2.32 Å
SCOPe Domain Sequences for d5i3cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i3cb_ c.56.2.1 (B:) Purine nucleoside phosphorylase, PNP {Escherichia coli [TaxId: 331111]} atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk
Timeline for d5i3cb_: