Lineage for d5goum_ (5gou M:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315402Protein automated matches [190041] (34 species)
    not a true protein
  7. 2315702Species Human (Homo sapiens) [TaxId:9606] [187027] (50 PDB entries)
  8. 2315855Domain d5goum_: 5gou M: [329983]
    automated match to d3ajoa_

Details for d5goum_

PDB Entry: 5gou (more details), 2.91 Å

PDB Description: structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign
PDB Compounds: (M:) ferritin heavy chain

SCOPe Domain Sequences for d5goum_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5goum_ a.25.1.1 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdk
ndphlcdfiethy

SCOPe Domain Coordinates for d5goum_:

Click to download the PDB-style file with coordinates for d5goum_.
(The format of our PDB-style files is described here.)

Timeline for d5goum_: