![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins) automatically mapped to Pfam PF00483 |
![]() | Protein automated matches [191218] (6 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [329970] (8 PDB entries) |
![]() | Domain d5fuhd_: 5fuh D: [329978] automated match to d1fxob_ complexed with cl, gol, hkx, mes |
PDB Entry: 5fuh (more details), 1.6 Å
SCOPe Domain Sequences for d5fuhd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fuhd_ c.68.1.6 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} krkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdtp rfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhel lgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydqq vvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfiat lenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy
Timeline for d5fuhd_: