SCOPe 2.06: Domain d5fuqb_: 5fuq B:

Lineage for d5fuqb_ (5fuq B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.3: Quinone reductase [52235] (4 proteins)
   binds FAD

6. Protein automated matches [190235] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187003] (7 PDB entries)

8. Domain d5fuqb_: 5fuq B: [329975]
   automated match to d1d4aa_
   complexed with act, dtc, fad

Details for d5fuqb_

PDB Entry: 5fuq, 2.04 Å

PDB Description: crystal structure of the h80r variant of nqo1 bound to dicoumarol

PDB Compounds: (B:) nad(p)h dehydrogenase [quinone] 1

SCOPe Domain Sequences for d5fuqb_:

Sequence; same for both SEQRES and ATOM records:

>d5fuqb_ c.23.5.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvgrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgkl
kdpanfqypaesvlaykegrlspdivaeqkkleaadlvifqfplqwfgvpailkgwferv
figefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfc
gfqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmk
kevqdeeknkkfglsvghhlgksiptdnqikar

Timeline for d5fuqb_:

• d5fuqb_ is new in SCOPe 2.06-stable
  
• d5fuqb_ appears in SCOPe 2.07
  
• d5fuqb_ appears in the current release, SCOPe 2.08