| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (73 species) not a true protein |
| Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [329973] (2 PDB entries) |
| Domain d5ft3b2: 5ft3 B:87-221 [329974] Other proteins in same PDB: d5ft3a1, d5ft3b1 automated match to d3zmka2 complexed with gsh |
PDB Entry: 5ft3 (more details), 1.43 Å
SCOPe Domain Sequences for d5ft3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ft3b2 a.45.1.0 (B:87-221) automated matches {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]}
skelvkqaklnaalhfesgvlfarlrfvcepilfaggseipadraeyvqkayqlledtlv
ddyivgnsltiadfscvssvssimgvipmdkekfpkiygwldrlkalpyyeaangsgaeq
vaqfvlsqkeknaqk
Timeline for d5ft3b2: