Lineage for d5ft3b2 (5ft3 B:87-221)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714342Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [329973] (2 PDB entries)
  8. 2714344Domain d5ft3b2: 5ft3 B:87-221 [329974]
    Other proteins in same PDB: d5ft3a1, d5ft3b1
    automated match to d3zmka2
    complexed with gsh

Details for d5ft3b2

PDB Entry: 5ft3 (more details), 1.43 Å

PDB Description: aedes aegypti gste2
PDB Compounds: (B:) glutathione s-transferase epsilon 2

SCOPe Domain Sequences for d5ft3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ft3b2 a.45.1.0 (B:87-221) automated matches {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]}
skelvkqaklnaalhfesgvlfarlrfvcepilfaggseipadraeyvqkayqlledtlv
ddyivgnsltiadfscvssvssimgvipmdkekfpkiygwldrlkalpyyeaangsgaeq
vaqfvlsqkeknaqk

SCOPe Domain Coordinates for d5ft3b2:

Click to download the PDB-style file with coordinates for d5ft3b2.
(The format of our PDB-style files is described here.)

Timeline for d5ft3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ft3b1