SCOP 1.55: Domain d1b48a2: 1b48 A:2-79

Lineage for d1b48a2 (1b48 A:2-79)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)

6. Protein Glutathione S-transferase [52863] (22 species)

7. Species Mouse (Mus musculus), class alpha (a1-4) [TaxId:10090] [52873] (2 PDB entries)

8. Domain d1b48a2: 1b48 A:2-79 [32997]
   Other proteins in same PDB: d1b48a1, d1b48b1

Details for d1b48a2

PDB Entry: 1b48, 2.6 Å

PDB Description: crystal structure of mgsta4-4 in complex with gsh conjugate of 4-hydroxynonenal in one subunit and gsh in the other: evidence of signaling across dimer interface in mgsta4-4

SCOP Domain Sequences for d1b48a2:

Sequence; same for both SEQRES and ATOM records:

>d1b48a2 c.47.1.5 (A:2-79) Glutathione S-transferase {Mouse (Mus musculus), class alpha (a1-4)}
aakpklyyfngrgrmesirwllaaagvefeeefletreqyekmqkdghllfgqvplveid
gmmltqtrailsylaaky

Timeline for d1b48a2:

• d1b48a2 appears in SCOP 1.57
  
• d1b48a2 appears in the current release, SCOPe 2.08