| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d5u16e1: 5u16 E:1-110 [329967] Other proteins in same PDB: d5u16a1, d5u16a3, d5u16b_, d5u16c1, d5u16d_, d5u16e2, d5u16g2 automated match to d2f54d1 complexed with 7wo, cl, gol, na |
PDB Entry: 5u16 (more details), 2 Å
SCOPe Domain Sequences for d5u16e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u16e1 b.1.1.0 (E:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrf
ssflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpd
Timeline for d5u16e1: