Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [256383] (17 PDB entries) |
Domain d5wt9g_: 5wt9 G: [329966] Other proteins in same PDB: d5wt9h_, d5wt9l1, d5wt9l2 automated match to d3rrqa_ |
PDB Entry: 5wt9 (more details), 2.4 Å
SCOPe Domain Sequences for d5wt9g_:
Sequence, based on SEQRES records: (download)
>d5wt9g_ b.1.1.1 (G:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]} ldspdrpwnpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpe drsqpgqdcrfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslrael
>d5wt9g_ b.1.1.1 (G:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]} ldspdrpwnpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpe rfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslrael
Timeline for d5wt9g_: