Lineage for d5umha_ (5umh A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2379685Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2380104Family b.3.6.0: automated matches [227249] (1 protein)
    not a true family
  6. 2380105Protein automated matches [227026] (6 species)
    not a true protein
  7. 2380111Species Burkholderia multivorans [TaxId:395019] [329904] (1 PDB entry)
  8. 2380112Domain d5umha_: 5umh A: [329963]
    automated match to d1dmha_
    complexed with ca, cl, edo, pg4, pg6, zn

Details for d5umha_

PDB Entry: 5umh (more details), 1.35 Å

PDB Description: crystal structure of catechol 1,2-dioxygenase protein from burkholderia multivorans
PDB Compounds: (A:) catechol 1,2-dioxygenase

SCOPe Domain Sequences for d5umha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5umha_ b.3.6.0 (A:) automated matches {Burkholderia multivorans [TaxId: 395019]}
vkvfdtkevqdllkaaanlngdagnarfrqivhrllsdlfkaiddlditpdevwagvnyl
nklgqdgeaallaagiglekyldirmdaadraagldggtprtiegplyvagapvrdgvak
idldddadagplvirgtvtgtdgkplagalvecwhanskgfyshfdptgaqtafnlrgav
rtdangkyefrtlmpvgygcppqgatqqllnglgrhgnrpahvhffvsgdghrklttqfn
iegdpliwddfayatreeliphvvdktggaalgmksdaykeiefdivltplldgrdnqvv
hrprasa

SCOPe Domain Coordinates for d5umha_:

Click to download the PDB-style file with coordinates for d5umha_.
(The format of our PDB-style files is described here.)

Timeline for d5umha_: