SCOPe 2.06: Domain d5u8pa_: 5u8p A:

Lineage for d5u8pa_ (5u8p A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [193149] (10 PDB entries)

8. Domain d5u8pa_: 5u8p A: [329952]
   automated match to d3r3sa_
   complexed with mg, nad

Details for d5u8pa_

PDB Entry: 5u8p, 1.4 Å

PDB Description: crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with nad

PDB Compounds: (A:) Short chain dehydrogenase

SCOPe Domain Sequences for d5u8pa_:

Sequence; same for both SEQRES and ATOM records:

>d5u8pa_ c.2.1.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
gltnpvdlypkppfphqvqappglasrmqprpdhgeqsyrgrgrlvgrktlvtggdsgig
raaaiafaregadvaigylpveesdarevvaliraagrqavalpgdirdetfcqrlvara
aealggldilvnnaarqqaldsigemttehfdatvktnlygmfwitkaaiphlppgasii
nttsvqavrasanlldyattkagiiaftrslakqlgprgirvnavapgpywtplqssggq
ppetvvnyaagspygrpgqpaeiaplyvalaasetsyangqvwgadgglgif

Timeline for d5u8pa_:

• d5u8pa_ is new in SCOPe 2.06-stable
  
• d5u8pa_ appears in SCOPe 2.07
  
• d5u8pa_ appears in the current release, SCOPe 2.08