Lineage for d5mhrj1 (5mhr J:1-94)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761216Domain d5mhrj1: 5mhr J:1-94 [329950]
    Other proteins in same PDB: d5mhrg2, d5mhrh2, d5mhro2, d5mhrq2
    automated match to d4odhl1

Details for d5mhrj1

PDB Entry: 5mhr (more details), 3 Å

PDB Description: t3d reovirus sigma1 complexed with 9bg5 fab fragments
PDB Compounds: (J:) 9BG5 Fab light chain,LOC100046793 protein,MAb 110 light chain

SCOPe Domain Sequences for d5mhrj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mhrj1 b.1.1.0 (J:1-94) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eivltqspttmaaspgekiiitcsasssissnylhwyqqkpgcspklliyrtsklasgvp
arfsgsgsgtsysltigtmeaedvatyycqqgss

SCOPe Domain Coordinates for d5mhrj1:

Click to download the PDB-style file with coordinates for d5mhrj1.
(The format of our PDB-style files is described here.)

Timeline for d5mhrj1: