Lineage for d5ugua_ (5ugu A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842037Protein Enoyl-ACP reductase [51791] (11 species)
  7. 2842170Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (96 PDB entries)
  8. 2842287Domain d5ugua_: 5ugu A: [329949]
    automated match to d2ie0a_
    complexed with nad, xtv

Details for d5ugua_

PDB Entry: 5ugu (more details), 1.95 Å

PDB Description: crystal structure of m. tuberculosis inha inhibited by pt506
PDB Compounds: (A:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d5ugua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ugua_ c.2.1.2 (A:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
vcallsdwlpattgdiiyadggahtqll

SCOPe Domain Coordinates for d5ugua_:

Click to download the PDB-style file with coordinates for d5ugua_.
(The format of our PDB-style files is described here.)

Timeline for d5ugua_: