Lineage for d5mhro2 (5mhr O:108-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753302Domain d5mhro2: 5mhr O:108-211 [329945]
    Other proteins in same PDB: d5mhrg1, d5mhrh1, d5mhri_, d5mhrj1, d5mhrk_, d5mhrl1, d5mhrm_, d5mhrn_, d5mhro1, d5mhrp_, d5mhrq1, d5mhrr_
    automated match to d1tqbc2

Details for d5mhro2

PDB Entry: 5mhr (more details), 3 Å

PDB Description: t3d reovirus sigma1 complexed with 9bg5 fab fragments
PDB Compounds: (O:) 9BG5 Fab light chain,LOC100046793 protein,MAb 110 light chain

SCOPe Domain Sequences for d5mhro2:

Sequence, based on SEQRES records: (download)

>d5mhro2 b.1.1.2 (O:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Sequence, based on observed residues (ATOM records): (download)

>d5mhro2 b.1.1.2 (O:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivsfnr

SCOPe Domain Coordinates for d5mhro2:

Click to download the PDB-style file with coordinates for d5mhro2.
(The format of our PDB-style files is described here.)

Timeline for d5mhro2: