SCOPe 2.08: Domain d5mhro1: 5mhr O:1-107

Lineage for d5mhro1 (5mhr O:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5mhro1: 5mhr O:1-107 [329944]
   Other proteins in same PDB: d5mhrg2, d5mhrh2, d5mhro2, d5mhrq2
   automated match to d1a5fl1

Details for d5mhro1

PDB Entry: 5mhr, 3 Å

PDB Description: t3d reovirus sigma1 complexed with 9bg5 fab fragments

PDB Compounds: (O:) 9BG5 Fab light chain,LOC100046793 protein,MAb 110 light chain

SCOPe Domain Sequences for d5mhro1:

Sequence; same for both SEQRES and ATOM records:

>d5mhro1 b.1.1.0 (O:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eivltqspttmaaspgekiiitcsasssissnylhwyqqkpgcspklliyrtsklasgvp
arfsgsgsgtsysltigtmeaedvatyycqqgssiytfgggtkleik

Timeline for d5mhro1:

• d5mhro1 first appeared in SCOPe 2.06
  
• d5mhro1 appears in SCOPe 2.07