![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.0: automated matches [191333] (1 protein) not a true family |
![]() | Protein automated matches [190172] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225276] (7 PDB entries) |
![]() | Domain d5uc9c_: 5uc9 C: [329942] automated match to d2rgzb_ complexed with myr |
PDB Entry: 5uc9 (more details), 1.9 Å
SCOPe Domain Sequences for d5uc9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uc9c_ a.132.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} adlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemernkd hpafaplyfpmelhrkealtkdmeyffgenweeqvqcpkaaqkyverihyigqnepellv ahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmnald lnmktkeriveeankafeynmqifneldqa
Timeline for d5uc9c_: