Lineage for d5uc8a_ (5uc8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732860Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 2732861Protein automated matches [190172] (9 species)
    not a true protein
  7. 2732867Species Human (Homo sapiens) [TaxId:9606] [225276] (7 PDB entries)
  8. 2732872Domain d5uc8a_: 5uc8 A: [329941]
    automated match to d2rgzb_

Details for d5uc8a_

PDB Entry: 5uc8 (more details), 2 Å

PDB Description: crystal structure of human heme oxygenase-2
PDB Compounds: (A:) Heme oxygenase 2

SCOPe Domain Sequences for d5uc8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uc8a_ a.132.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemernkd
hpafaplyfpmelhrkealtkdmeyffgenweeqvqcpkaaqkyverihyigqnepellv
ahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmnald
lnmktkeriveeankafeynmqifneldq

SCOPe Domain Coordinates for d5uc8a_:

Click to download the PDB-style file with coordinates for d5uc8a_.
(The format of our PDB-style files is described here.)

Timeline for d5uc8a_: