SCOP 1.63: Domain d1f3bb2: 1f3b B:1-79

Lineage for d1f3bb2 (1f3b B:1-79)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)

6. Protein Class alpha GST [81360] (6 species)

7. Species Mouse (Mus musculus), (a1-1) [TaxId:10090] [52872] (2 PDB entries)

8. Domain d1f3bb2: 1f3b B:1-79 [32994]
   Other proteins in same PDB: d1f3ba1, d1f3bb1
   complexed with gbx

Details for d1f3bb2

PDB Entry: 1f3b, 2 Å

PDB Description: crystal structure of mgsta1-1 in complex with glutathione conjugate of benzo[a]pyrene epoxide

SCOP Domain Sequences for d1f3bb2:

Sequence; same for both SEQRES and ATOM records:

>d1f3bb2 c.47.1.5 (B:1-79) Class alpha GST {Mouse (Mus musculus), (a1-1)}
agkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveid
gmklaqtrailnyiatkyd

Timeline for d1f3bb2:

• d1f3bb2 first appeared (with stable ids) in SCOP 1.55
  
• d1f3bb2 appears in SCOP 1.61
  
• d1f3bb2 appears in SCOP 1.65
  
• d1f3bb2 appears in the current release, SCOPe 2.08