Lineage for d1f3ba2 (1f3b A:1-79)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24235Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)
  6. 24236Protein Glutathione S-transferase [52863] (22 species)
  7. 24395Species Mouse (Mus musculus), class alpha (a1-1) [TaxId:10090] [52872] (2 PDB entries)
  8. 24396Domain d1f3ba2: 1f3b A:1-79 [32993]
    Other proteins in same PDB: d1f3ba1, d1f3bb1

Details for d1f3ba2

PDB Entry: 1f3b (more details), 2 Å

PDB Description: crystal structure of mgsta1-1 in complex with glutathione conjugate of benzo[a]pyrene epoxide

SCOP Domain Sequences for d1f3ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3ba2 c.47.1.5 (A:1-79) Glutathione S-transferase {Mouse (Mus musculus), class alpha (a1-1)}
agkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveid
gmklaqtrailnyiatkyd

SCOP Domain Coordinates for d1f3ba2:

Click to download the PDB-style file with coordinates for d1f3ba2.
(The format of our PDB-style files is described here.)

Timeline for d1f3ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f3ba1