| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
| Protein automated matches [227126] (21 species) not a true protein |
| Species Scheffersomyces stipitis [TaxId:322104] [328848] (25 PDB entries) |
| Domain d5i4ia2: 5i4i A:335-531 [329926] Other proteins in same PDB: d5i4ia3 automated match to d1gpua2 |
PDB Entry: 5i4i (more details), 1.06 Å
SCOPe Domain Sequences for d5i4ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i4ia2 c.36.1.0 (A:335-531) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
lpenwdkalpvytpadaavatrklseivlskiipevpeiiggsadltpsnltkakgtvdf
qpaatglgdysgryirygvrehamgaimngiaafganyknyggtflnfvsyaagavrlsa
lsefpitwvathdsiglgedgpthqpietlahfratpnisvwrpadgnetsaayksaies
thtphilaltrqnlpql
Timeline for d5i4ia2: