SCOPe 2.08: Domain d5wt9l1: 5wt9 L:-2-106

Lineage for d5wt9l1 (5wt9 L:-2-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d5wt9l1: 5wt9 L:-2-106 [329923]
   Other proteins in same PDB: d5wt9g_, d5wt9l2
   automated match to d1dn0a1

Details for d5wt9l1

PDB Entry: 5wt9, 2.4 Å

PDB Description: complex structure of pd-1 and nivolumab-fab

PDB Compounds: (L:) Light Chain of Nivolumab

SCOPe Domain Sequences for d5wt9l1:

Sequence; same for both SEQRES and ATOM records:

>d5wt9l1 b.1.1.1 (L:-2-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stgeivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratg
iparfsgsgsgtdftltisslepedfavyycqqssnwprtfgqgtkvei

Timeline for d5wt9l1:

• d5wt9l1 first appeared in SCOPe 2.06
  
• d5wt9l1 appears in SCOPe 2.07