Lineage for d5um0c1 (5um0 C:1-227)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890965Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2890966Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2891217Family c.60.1.0: automated matches [196988] (1 protein)
    not a true family
  6. 2891218Protein automated matches [196989] (16 species)
    not a true protein
  7. 2891269Species Neisseria gonorrhoeae [TaxId:521006] [329884] (1 PDB entry)
  8. 2891272Domain d5um0c1: 5um0 C:1-227 [329921]
    Other proteins in same PDB: d5um0a2, d5um0b2, d5um0c2, d5um0d2
    automated match to d3gp3a_
    complexed with tla

Details for d5um0c1

PDB Entry: 5um0 (more details), 1.85 Å

PDB Description: crystal structure of 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase from neisseria gonorrhoeae
PDB Compounds: (C:) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

SCOPe Domain Sequences for d5um0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5um0c1 c.60.1.0 (C:1-227) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
melvfirhgqsewnaknlftgwrdvklseqglaeaaaagkklkengyefdiaftsvltra
iktcnivleesdqlfvpqiktwrlnerhygrlqgldkkqtaekygdeqvriwrrsydtlp
plldkddafsahkdrryahlpadvvpdgenlkvtlervlpfwedqiapailsgkrvlvaa
hgnslralakhiegisdedimgleiptgqplvyklddnlkviekfyl

SCOPe Domain Coordinates for d5um0c1:

Click to download the PDB-style file with coordinates for d5um0c1.
(The format of our PDB-style files is described here.)

Timeline for d5um0c1: