SCOPe 2.08: Domain d5mhrg2: 5mhr G:108-211

Lineage for d5mhrg2 (5mhr G:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d5mhrg2: 5mhr G:108-211 [329920]
   Other proteins in same PDB: d5mhrg1, d5mhrh1, d5mhri_, d5mhrj1, d5mhrk_, d5mhrl1, d5mhrm_, d5mhrn_, d5mhro1, d5mhrp_, d5mhrq1, d5mhrr_
   automated match to d1tqbc2

Details for d5mhrg2

PDB Entry: 5mhr, 3 Å

PDB Description: t3d reovirus sigma1 complexed with 9bg5 fab fragments

PDB Compounds: (G:) 9BG5 Fab light chain,LOC100046793 protein,MAb 110 light chain

SCOPe Domain Sequences for d5mhrg2:

Sequence; same for both SEQRES and ATOM records:

>d5mhrg2 b.1.1.2 (G:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d5mhrg2:

• d5mhrg2 first appeared in SCOPe 2.06
  
• d5mhrg2 appears in SCOPe 2.07