![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein automated matches [190035] (28 species) not a true protein |
![]() | Species Dioclea reflexa [TaxId:1048258] [329869] (1 PDB entry) |
![]() | Domain d5tg3b_: 5tg3 B: [329911] automated match to d4nota_ complexed with ca, mn, xmm |
PDB Entry: 5tg3 (more details), 1.77 Å
SCOPe Domain Sequences for d5tg3b_:
Sequence, based on SEQRES records: (download)
>d5tg3b_ b.29.1.1 (B:) automated matches {Dioclea reflexa [TaxId: 1048258]} adtivaveldsypntdigdpnyphigidiksvrskstarwnmqtgkvgtvhisynsvskr lsavvsysgsssttvsydvdlnnvlpewvrvglsattglykqtntilswsftsklktnsi adenslhfsfhkfsqnpkdlilqgdastdsdgnlqltkvsssgdpqgnsvgralfyapvh iweksavvasfdatftflikspdrepadgitffiantdttipsgsggrllglfpdan
>d5tg3b_ b.29.1.1 (B:) automated matches {Dioclea reflexa [TaxId: 1048258]} adtivaveldsypntdigdpnyphigidiksvrskstarwnmqtgkvgtvhisynsvskr lsavvsysgsssttvsydvdlnnvlpewvrvglsattglykqtntilswsftsklknslh fsfhkfsqnpkdlilqgdastdsdgnlqltkvsssgdpqgnsvgralfyapvhiweksav vasfdatftflikspdrepadgitffiantdttipsgsggrllglfpdan
Timeline for d5tg3b_: