SCOPe 2.08: Domain d5uq4a_: 5uq4 A:

Lineage for d5uq4a_ (5uq4 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [329909] (4 PDB entries)

8. Domain d5uq4a_: 5uq4 A: [329910]
   Other proteins in same PDB: d5uq4b2
   automated match to d3hx9a_

Details for d5uq4a_

PDB Entry: 5uq4, 2.2 Å

PDB Description: crystal structure of heme-degrading protein rv3592 from mycobacterium tuberculosis - heme free with cleaved protein

PDB Compounds: (A:) monooxygenase

SCOPe Domain Sequences for d5uq4a_:

Sequence, based on SEQRES records:

>d5uq4a_ d.58.4.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mpvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthwesd
eafqawangpaiaahaghranpvatgasllefevvldvg

Sequence, based on observed residues (ATOM records):

>d5uq4a_ d.58.4.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mpvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthwesd
eafqawangpaiaasllefevvldvg

Timeline for d5uq4a_:

• d5uq4a_ first appeared in SCOPe 2.06
  
• d5uq4a_ appears in SCOPe 2.07