Lineage for d1ev9a2 (1ev9 A:2-79)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 70930Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)
  6. 70934Protein Glutathione S-transferase [52863] (24 species)
  7. 71137Species Rat (Rattus norvegicus), class alpha (a1-1) [TaxId:10116] [52871] (2 PDB entries)
  8. 71141Domain d1ev9a2: 1ev9 A:2-79 [32990]
    Other proteins in same PDB: d1ev9a1, d1ev9c1, d1ev9d1

Details for d1ev9a2

PDB Entry: 1ev9 (more details), 2.2 Å

PDB Description: rat glutathione s-transferase a1-1 mutant w21f with gso3 bound

SCOP Domain Sequences for d1ev9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ev9a2 c.47.1.5 (A:2-79) Glutathione S-transferase {Rat (Rattus norvegicus), class alpha (a1-1)}
sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
gmklaqtrailnyiatky

SCOP Domain Coordinates for d1ev9a2:

Click to download the PDB-style file with coordinates for d1ev9a2.
(The format of our PDB-style files is described here.)

Timeline for d1ev9a2: