Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (10 families) |
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins) |
Protein Glutathione S-transferase [52863] (22 species) |
Species Rat (Rattus norvegicus), class alpha (a1-1) [TaxId:10116] [52871] (2 PDB entries) |
Domain d1ev9a2: 1ev9 A:2-79 [32990] Other proteins in same PDB: d1ev9a1, d1ev9c1, d1ev9d1 |
PDB Entry: 1ev9 (more details), 2.2 Å
SCOP Domain Sequences for d1ev9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ev9a2 c.47.1.5 (A:2-79) Glutathione S-transferase {Rat (Rattus norvegicus), class alpha (a1-1)} sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid gmklaqtrailnyiatky
Timeline for d1ev9a2:
View in 3D Domains from other chains: (mouse over for more information) d1ev9c1, d1ev9c2, d1ev9d1, d1ev9d2 |