![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
![]() | Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) ![]() |
![]() | Family c.60.1.0: automated matches [196988] (1 protein) not a true family |
![]() | Protein automated matches [196989] (16 species) not a true protein |
![]() | Species Neisseria gonorrhoeae [TaxId:521006] [329884] (1 PDB entry) |
![]() | Domain d5um0a1: 5um0 A:1-227 [329891] Other proteins in same PDB: d5um0a2, d5um0b2, d5um0c2, d5um0d2 automated match to d3gp3a_ complexed with tla |
PDB Entry: 5um0 (more details), 1.85 Å
SCOPe Domain Sequences for d5um0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5um0a1 c.60.1.0 (A:1-227) automated matches {Neisseria gonorrhoeae [TaxId: 521006]} melvfirhgqsewnaknlftgwrdvklseqglaeaaaagkklkengyefdiaftsvltra iktcnivleesdqlfvpqiktwrlnerhygrlqgldkkqtaekygdeqvriwrrsydtlp plldkddafsahkdrryahlpadvvpdgenlkvtlervlpfwedqiapailsgkrvlvaa hgnslralakhiegisdedimgleiptgqplvyklddnlkviekfyl
Timeline for d5um0a1: