SCOPe 2.08: Domain d5um0a1: 5um0 A:1-227

Lineage for d5um0a1 (5um0 A:1-227)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.0: automated matches [196988] (1 protein)
   not a true family

6. Protein automated matches [196989] (16 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:521006] [329884] (1 PDB entry)

8. Domain d5um0a1: 5um0 A:1-227 [329891]
   Other proteins in same PDB: d5um0a2, d5um0b2, d5um0c2, d5um0d2
   automated match to d3gp3a_
   complexed with tla

Details for d5um0a1

PDB Entry: 5um0, 1.85 Å

PDB Description: crystal structure of 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase from neisseria gonorrhoeae

PDB Compounds: (A:) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

SCOPe Domain Sequences for d5um0a1:

Sequence; same for both SEQRES and ATOM records:

>d5um0a1 c.60.1.0 (A:1-227) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
melvfirhgqsewnaknlftgwrdvklseqglaeaaaagkklkengyefdiaftsvltra
iktcnivleesdqlfvpqiktwrlnerhygrlqgldkkqtaekygdeqvriwrrsydtlp
plldkddafsahkdrryahlpadvvpdgenlkvtlervlpfwedqiapailsgkrvlvaa
hgnslralakhiegisdedimgleiptgqplvyklddnlkviekfyl

Timeline for d5um0a1:

• d5um0a1 first appeared in SCOPe 2.06
  
• d5um0a1 appears in SCOPe 2.07