Lineage for d5tnba_ (5tnb A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2335233Protein Estrogen receptor alpha [48519] (1 species)
  7. 2335234Species Human (Homo sapiens) [TaxId:9606] [48520] (71 PDB entries)
    Uniprot P03372 307-551
  8. 2335310Domain d5tnba_: 5tnb A: [329887]
    automated match to d3q95b_
    complexed with 7eb

Details for d5tnba_

PDB Entry: 5tnb (more details), 2.08 Å

PDB Description: crystal structure of the er-alpha ligand-binding domain (l372s,l536s) in complex with the obhs-bsc, 4-bromophenyl (1r,2r,4s)-6-(4-(2- (dimethylamino)ethoxy)phenyl)-5-(4-hydroxyphenyl)-7- oxabicyclo[2.2.1]hept-5-ene-2-sulfonate
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d5tnba_:

Sequence, based on SEQRES records: (download)

>d5tnba_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsydlllemld
a

Sequence, based on observed residues (ATOM records): (download)

>d5tnba_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrmveifdmllatss
rfrmmnlqgeefvclksiillnsgvytfltlksleekdhihrvldkitdtlihlmakagl
tlqqqhqrlaqlllilshirhmsnkgmehlysmkvpsydlllemlda

SCOPe Domain Coordinates for d5tnba_:

Click to download the PDB-style file with coordinates for d5tnba_.
(The format of our PDB-style files is described here.)

Timeline for d5tnba_: