| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
| Family a.132.1.0: automated matches [191333] (1 protein) not a true family |
| Protein automated matches [190172] (9 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225276] (7 PDB entries) |
| Domain d5uc8d_: 5uc8 D: [329881] automated match to d2rgzb_ |
PDB Entry: 5uc8 (more details), 2 Å
SCOPe Domain Sequences for d5uc8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uc8d_ a.132.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemernkd
hpafaplyfpmelhrkealtkdmeyffgenweeqvqcpkaaqkyverihyigqnepellv
ahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmnald
lnmktkeriveeankafeynmqifneldqa
Timeline for d5uc8d_: