SCOP 1.55: Domain d1ev4c2: 1ev4 C:2-79

Lineage for d1ev4c2 (1ev4 C:2-79)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)

6. Protein Glutathione S-transferase [52863] (22 species)

7. Species Rat (Rattus norvegicus), class alpha (a1-1) [TaxId:10116] [52871] (2 PDB entries)

8. Domain d1ev4c2: 1ev4 C:2-79 [32988]
   Other proteins in same PDB: d1ev4a1, d1ev4c1, d1ev4d1

Details for d1ev4c2

PDB Entry: 1ev4, 2.2 Å

PDB Description: rat glutathione s-transferase a1-1: mutant w21f/f220y with gso3 bound

SCOP Domain Sequences for d1ev4c2:

Sequence; same for both SEQRES and ATOM records:

>d1ev4c2 c.47.1.5 (C:2-79) Glutathione S-transferase {Rat (Rattus norvegicus), class alpha (a1-1)}
sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
gmklaqtrailnyiatky

Timeline for d1ev4c2:

• d1ev4c2 appears in SCOP 1.57
  
• d1ev4c2 appears in the current release, SCOPe 2.08