Lineage for d5uc8c_ (5uc8 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338543Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2338544Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2338785Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 2338786Protein automated matches [190172] (9 species)
    not a true protein
  7. 2338792Species Human (Homo sapiens) [TaxId:9606] [225276] (7 PDB entries)
  8. 2338799Domain d5uc8c_: 5uc8 C: [329867]
    automated match to d2rgzb_

Details for d5uc8c_

PDB Entry: 5uc8 (more details), 2 Å

PDB Description: crystal structure of human heme oxygenase-2
PDB Compounds: (C:) Heme oxygenase 2

SCOPe Domain Sequences for d5uc8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uc8c_ a.132.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemernkd
hpafaplyfpmelhrkealtkdmeyffgenweeqvqcpkaaqkyverihyigqnepellv
ahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmnald
lnmktkeriveeankafeynmqifneldqa

SCOPe Domain Coordinates for d5uc8c_:

Click to download the PDB-style file with coordinates for d5uc8c_.
(The format of our PDB-style files is described here.)

Timeline for d5uc8c_: