Lineage for d1agsb2 (1ags B:1-79)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484529Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2484540Protein Class alpha GST [81360] (8 species)
  7. 2484553Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (35 PDB entries)
    Uniprot P08263
  8. 2484662Domain d1agsb2: 1ags B:1-79 [32986]
    Other proteins in same PDB: d1agsa1, d1agsb1
    complexed with gtx; mutant

Details for d1agsb2

PDB Entry: 1ags (more details), 2.5 Å

PDB Description: a surface mutant (g82r) of a human alpha-glutathione s-transferase shows decreased thermal stability and a new mode of molecular association in the crystal
PDB Compounds: (B:) glutathione s-transferase alpha

SCOPe Domain Sequences for d1agsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agsb2 c.47.1.5 (B:1-79) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOPe Domain Coordinates for d1agsb2:

Click to download the PDB-style file with coordinates for d1agsb2.
(The format of our PDB-style files is described here.)

Timeline for d1agsb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1agsb1