SCOPe 2.08: Domain d5mvzb2: 5mvz B:108-214

Lineage for d5mvzb2 (5mvz B:108-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5mvzb2: 5mvz B:108-214 [329841]
   Other proteins in same PDB: d5mvzu_, d5mvzv_
   automated match to d1h3pl2
   complexed with gol

Details for d5mvzb2

PDB Entry: 5mvz, 2.15 Å

PDB Description: fab 4ab007 bound to interleukin-1-beta

PDB Compounds: (B:) Fab 4AB007 L-chain

SCOPe Domain Sequences for d5mvzb2:

Sequence; same for both SEQRES and ATOM records:

>d5mvzb2 b.1.1.0 (B:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d5mvzb2:

• d5mvzb2 first appeared in SCOPe 2.06
  
• d5mvzb2 appears in SCOPe 2.07