Lineage for d1gumh2 (1gum H:4-80)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1368661Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1368672Protein Class alpha GST [81360] (8 species)
  7. 1368687Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (28 PDB entries)
    Uniprot P08263
  8. 1368779Domain d1gumh2: 1gum H:4-80 [32984]
    Other proteins in same PDB: d1guma1, d1gumb1, d1gumc1, d1gumd1, d1gume1, d1gumf1, d1gumg1, d1gumh1

Details for d1gumh2

PDB Entry: 1gum (more details), 3 Å

PDB Description: human glutathione transferase a4-4 without ligands
PDB Compounds: (H:) protein (glutathione transferase a4-4)

SCOPe Domain Sequences for d1gumh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gumh2 c.47.1.5 (H:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
klvqtrsilhyiadkhn

SCOPe Domain Coordinates for d1gumh2:

Click to download the PDB-style file with coordinates for d1gumh2.
(The format of our PDB-style files is described here.)

Timeline for d1gumh2: