Lineage for d5mmua_ (5mmu A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975505Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2975569Protein automated matches [190058] (11 species)
    not a true protein
  7. 2975570Species Apple (Malus domestica) [TaxId:3750] [329831] (1 PDB entry)
  8. 2975571Domain d5mmua_: 5mmu A: [329832]
    automated match to d1e09a_

Details for d5mmua_

PDB Entry: 5mmu (more details)

PDB Description: nmr solution structure of the major apple allergen mal d 1
PDB Compounds: (A:) Major allergen Mal d 1

SCOPe Domain Sequences for d5mmua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mmua_ d.129.3.1 (A:) automated matches {Apple (Malus domestica) [TaxId: 3750]}
gvytfeneftseippsrlfkafvldadnlipkiapqaikqaeilegnggpgtikkitfge
gsqygyvkhridsideasysysytliegdaltdtiekisyetklvacgsgstiksishyh
tkgnieikeehvkvgkekahglfkliesylkdhpdayn

SCOPe Domain Coordinates for d5mmua_:

Click to download the PDB-style file with coordinates for d5mmua_.
(The format of our PDB-style files is described here.)

Timeline for d5mmua_: