Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Factor D [50563] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50564] (29 PDB entries) |
Domain d5mt4a_: 5mt4 A: [329823] automated match to d1op8a_ complexed with m7o |
PDB Entry: 5mt4 (more details), 1.65 Å
SCOPe Domain Sequences for d5mt4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mt4a_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
Timeline for d5mt4a_: