| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
| Domain d5mhrh2: 5mhr H:108-210 [329822] Other proteins in same PDB: d5mhrg1, d5mhrh1, d5mhri_, d5mhrj1, d5mhrk_, d5mhrl1, d5mhrm_, d5mhrn_, d5mhro1, d5mhrp_, d5mhrq1, d5mhrr_ automated match to d1tqbc2 |
PDB Entry: 5mhr (more details), 3 Å
SCOPe Domain Sequences for d5mhrh2:
Sequence, based on SEQRES records: (download)
>d5mhrh2 b.1.1.2 (H:108-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfn
>d5mhrh2 b.1.1.2 (H:108-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdkwkidgseqngvlnswtdqdskds
tysmsstltltkdeyerhnsytceathkstspivksfn
Timeline for d5mhrh2: