SCOPe 2.08: Domain d5knlc1: 5knl C:1-167

Lineage for d5knlc1 (5knl C:1-167)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.0: automated matches [191322] (1 protein)
   not a true family

6. Protein automated matches [190120] (9 species)
   not a true protein

7. Species Schizosaccharomyces pombe [TaxId:284812] [329787] (1 PDB entry)

8. Domain d5knlc1: 5knl C:1-167 [329812]
   Other proteins in same PDB: d5knlb_, d5knlc2, d5knle_, d5knlf2
   automated match to d2ucza_
   complexed with so4

Details for d5knlc1

PDB Entry: 5knl, 2.5 Å

PDB Description: crystal structure of s. pombe ubiquitin e1 (uba1) in complex with ubc15 and ubiquitin

PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 15

SCOPe Domain Sequences for d5knlc1:

Sequence; same for both SEQRES and ATOM records:

>d5knlc1 d.20.1.0 (C:1-167) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
mpssaseqllrkqlkeiqknppqgfsvglvddksifewevmiigpedtlyeggffhatls
fpqdyplmppkmkftteiwhpnvhpngevcisilhppgddkygyedagerwlpvhspeti
lisvismlsspndespanidaakefrenpqefkkrvrrlvrrsiemi

Timeline for d5knlc1:

• d5knlc1 first appeared in SCOPe 2.06
  
• d5knlc1 appears in SCOPe 2.07