Lineage for d1gume2 (1gum E:4-80)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24235Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)
  6. 24236Protein Glutathione S-transferase [52863] (22 species)
  7. 24252Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [52870] (7 PDB entries)
  8. 24273Domain d1gume2: 1gum E:4-80 [32981]
    Other proteins in same PDB: d1guma1, d1gumb1, d1gumc1, d1gumd1, d1gume1, d1gumf1, d1gumg1, d1gumh1

Details for d1gume2

PDB Entry: 1gum (more details), 3 Å

PDB Description: human glutathione transferase a4-4 without ligands

SCOP Domain Sequences for d1gume2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gume2 c.47.1.5 (E:4-80) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)}
rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
klvqtrsilhyiadkhn

SCOP Domain Coordinates for d1gume2:

Click to download the PDB-style file with coordinates for d1gume2.
(The format of our PDB-style files is described here.)

Timeline for d1gume2: