SCOPe 2.07: Domain d5imsb2: 5ims B:277-460

Lineage for d5imsb2 (5ims B:277-460)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
   N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold

6. Protein Acetohydroxyacid synthase catalytic subunit [69463] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [314108] (3 PDB entries)

8. Domain d5imsb2: 5ims B:277-460 [329800]
   Other proteins in same PDB: d5imsa1, d5imsa3, d5imsb1, d5imsb3
   automated match to d1n0ha1
   complexed with act, fad, k, mg, oxy, po4, tpp

Details for d5imsb2

PDB Entry: 5ims, 1.98 Å

PDB Description: saccharomyces cerevisiae acetohydroxyacid synthase

PDB Compounds: (B:) Acetolactate synthase catalytic subunit, mitochondrial

SCOPe Domain Sequences for d5imsb2:

Sequence; same for both SEQRES and ATOM records:

>d5imsb2 c.31.1.3 (B:277-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tsraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvtttlq
glgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearraa
aegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqinkwkk
eypy

Timeline for d5imsb2:

• d5imsb2 first appeared in SCOPe 2.06
  
• d5imsb2 appears in the current release, SCOPe 2.08