SCOP 1.75: Domain d1gumd2: 1gum D:4-80

Lineage for d1gumd2 (1gum D:4-80)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (23 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (19 PDB entries)
   Uniprot P08263

8. Domain d1gumd2: 1gum D:4-80 [32980]
   Other proteins in same PDB: d1guma1, d1gumb1, d1gumc1, d1gumd1, d1gume1, d1gumf1, d1gumg1, d1gumh1

Details for d1gumd2

PDB Entry: 1gum, 3 Å

PDB Description: human glutathione transferase a4-4 without ligands

PDB Compounds: (D:) protein (glutathione transferase a4-4)

SCOP Domain Sequences for d1gumd2:

Sequence; same for both SEQRES and ATOM records:

>d1gumd2 c.47.1.5 (D:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
klvqtrsilhyiadkhn

Timeline for d1gumd2:

• d1gumd2 first appeared (with stable ids) in SCOP 1.55
  
• d1gumd2 appears in SCOP 1.73
  
• d1gumd2 appears in SCOPe 2.01
  
• d1gumd2 appears in the current release, SCOPe 2.08